SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA26305 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA26305
Domain Number 1 Region: 92-191
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000208
Family Protein kinases, catalytic subunit 0.0038
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily SH2 domain 0.00000939
Family SH2 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA26305   Protein: PP20819   Gene: WBGene00115859
Sequence length 213
Comment PP20819 WBGene00115859 status:Predicted
Sequence
MSGLETIYMITVMMCNKKVVHVPLRKDSDNCRFVPPGEYCKYFDRMAFSTIADLINYCRI
HPFSSHLKCEKVVYRPPWWVKTVDIAYVDRLGTSGQFYKGTWKRKGGEAAVVIKKPIITP
TAFQASSIALMREARHMTSFKHDNVIQCVGMVYDCLPIILLTEFCAGGSLLRHLTTYGKD
TDVKEKIMYLYEVPYHQATEVLNYDDLHSKNIP
Download sequence
Identical sequences H3FVH2
PPA26305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]