SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA27700 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PPA27700
Domain Number - Region: 31-125
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00259
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA27700   Protein: PP16036   Gene: WBGene00117254
Sequence length 135
Comment PP16036 WBGene00117254 status:Partially_confirmed
Sequence
MQQVWENHKEITKRDSAIREAMNQQAQIGNLMSDLSGFEEQIYRTHLSFDLNRPGAEGAS
RNVQDLRSDLDSYAEKVRLKLETVDRLCHEGADTLTPEQFAELKEARARLERNYEAVVRT
VENLQTRNLRELLDM
Download sequence
Identical sequences H3FZF1
PPA27700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]