SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA27701 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA27701
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000059
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  PPA27701
Domain Number - Region: 60-192
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00791
Family Spectrin repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA27701   Protein: PP13640   Gene: WBGene00117255
Sequence length 204
Comment PP13640 WBGene00117255 status:Predicted
Sequence
MHSWITDATRRAGDIRANSADHRMLPEERRKAKALMEDIATKEHELKALNSLFVRLEAEI
DQMYAEAPAARDSGAIDAEEMRKTLGRVESDYTELYRSAADLSVFQNKIDALGGDVEAKG
RRTHEWLSRLEASLDENDGATIEEKLRRAEEMKEKVASDRSLLEEQEQAARQLLLALEGT
PAHTDVRERHEKALKEQRKSNESP
Download sequence
Identical sequences H3FZF2
PPA27701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]