SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA27703 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA27703
Domain Number 1 Region: 1182-1342
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-18
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 2 Region: 1305-1452
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-17
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 3 Region: 1514-1665
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000528
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 4 Region: 416-570
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000118
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 5 Region: 338-462
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000245
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 1736-1847
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000134
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 7 Region: 191-313
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000946
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  PPA27703
Domain Number - Region: 971-1125
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000201
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 776-893
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0662
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA27703   Protein: PP26528   Gene: WBGene00117257
Sequence length 1854
Comment PP26528 WBGene00117257 status:Predicted
Sequence
MTDEKESKQAVDQSTLERHEEVLDRVQSRVNDALAEKAAADGIKKAVGDLAAWSVAFERA
VEDTTRKGLPLKQASIDAKKSDEQRMRSEMDAHLALAEKLEKEAKQAGIAGLDEQVAEAR
KALKRSNSTLSGWRDNLSDASSYLADLAAGAAAAERTADHLAAVLKQTTPKDGERLAEVE
REMEALAGARDQLAETARKLLGLPDITEEDGVKNTIASVDGRIVAIAGELENKKRAAGEL
AEVEGEMEQNREEALAMLSSLEQRLLAASPVALSVAALGKQRSEVAEWQRELAAIAPLVE
RMEECAEKLYDGAGASSMRGGNNPAAGAKRAALETSGKLQSLDAAVAARSGRIVENESGL
AAFDRVADDLERWMGRETEKINSECGIPESADDASNIGRKIDRLEKEIRGERRLLEEATR
AGADLRRANAPDAAGADRVADRVRALEDEWGKMGEQIDEARARVRTAEQLHERAAGLAKW
MGAQRRHLDALGAPSADPAAAKAQKRQLELIRETIEDEAPTWSKVNEMASGLVKEAPENS
NYEKVVQKTDDLNRDWARLKDDVDKRLARVDAVAERGKRVDQMMRANPNSNNVQASGNIH
GALRDLKKEAGELEAECTRVAKMPSNEEQKRLESLDALLSRAADLDGALLNLDQSLKELS
LGDDDEAVEWTDVAEAVGAVRNRTDEISKRLEGMKAAALSARGKEEELDKQLDDLARSTR
ASLAEGGQPAADAARAADESKRMDDIVERLLGKDGEVAMAKVRAEELLKSRPGDISLREK
CERLAIEWTPLVEEARRRKAAASQLDDLLKQYDDQHDGLEKRMKEDEDEMARLLAILAAD
KDNAEAIQKLAELEGAADRRKAESEALDKLADRIDALAPGADARRLKRKSEKLGEDARAR
AKKTKAAIAGVGKKKDLHDRLAQLLDGASEQAASYAKEVEENGDKMDRTRVQSTQHAAAA
DWKRAEREIGAVADQLKEISPETADEIDAAIDRVREAFEAVNDDLVALDGQLEAAAEAAD
QAKEWAATVAASAVKLAEELSDTVEDIGRSPEDLDRNRRECDAQEEAIEKKIEEIENALA
DLQAARDSGIITPAQYENARAGLEEAKRAMEKAKKRIGQRRKRIDQVEAEIGRMRGDASA
VREALAALATAPVLCADQAKGDPTSQAAALKEIKEQLRPLSDRVTALVGDCQAMIKSAPP
EVNTKALDTLLRDTVGAHDEVAGKVAERERAIDAAAQQMGKYEDAYKALLNWLEETEEMM
ANQSDPSADAKVARAQRATFDVFLKHLEDKQTSVDGFSALIAKMRDLTSSEDEKAALKSK
DDQIKMRYADLLARAQEGQAKLRDAVDLAERYTNLEAPLRAWLATTEKAMNGLGQIPIDG
ERLEKQRAEQKRIEEELAEKRDDVKALVETGAMLAALVSVNDATDVTARADAMRRQYEQM
NGRCEACGESIENVAMHLDQFLAEFADLEGWLADMEMNMLSLDDLAIDDQDELAEQANLL
SELGVDVTEHEARFGDVITVGLELCRQTSREEAMALQHRIDALKMRVSDLSGVTDEKLEV
MERAIPLTERFHNGFEAAMEWIEAVEEDLRMLDEVPLETQLQIVANIEEDLQLWRPDIDQ
VVAMSSQLQAMTSQERASALHANTSDMNRRAGAIGDQVTRRSERLMMAERQSRGVMDELD
FVTEWLEEAKERVSAAAPPSIIPDYVKTQLKNQRLLNEDVATQRCRLRDTIAEAKKIARH
VGAEGSGLHDQALLAKAEAAKSLADEVADISEKRAERLEEALALSHQIEGAQDDIVDWLD
TMEREIETAPSVMTGTPMAALAAQQKHNMVRNTGRLRFELINSAEQKHNMVSGQ
Download sequence
Identical sequences H3FZF4
PPA27703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]