SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA27706 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA27706
Domain Number 1 Region: 17-143,187-295
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.6e-74
Family Calponin-homology domain, CH-domain 0.00000998
Further Details:      
 
Domain Number 2 Region: 1424-1559
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000366
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 3 Region: 841-881,924-1024
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000317
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 4 Region: 562-695
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000406
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 5 Region: 981-1135
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000216
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 6 Region: 750-888
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000648
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 7 Region: 1087-1238
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000468
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 8 Region: 1360-1456
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000017
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 9 Region: 424-526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000317
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 10 Region: 1586-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000504
Family Spectrin repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA27706   Protein: PP09747   Gene: WBGene00117260
Sequence length 1704
Comment PP09747 WBGene00117260 status:Predicted
Sequence
MTSKTTSNADNVEQEHLEHYESTRERYKDERDSIQKKTFTKWVNKHLKKASGNINDLFVD
LRDGNNLISLLEVLSDENLLRENGRTRFHRIQNIQYCLDWLKMKNIKLVNIRPDEIVEGN
GKLTLGLIWTIILNFQVSVIKQRQRADAQAAAAVRAAAAAAAAKTTAVGGEAGIVSPLNA
SMNTTLEALEGGSAKEALLAWNQRATDGYARVRVANFTSSWRDGLAFAAILHRHRPSAID
WEQISASSMTNCERLAIAFEVAKREFDVDKLLDPEDVDTDKPDEKSIITYVSTLYQNMPC
LPDKLQSPAVEAAVPSVEAEEEEGERWAEWTERVLLALGSTRRIGLASLPEAEVNEIEGV
RLALASTRIDHVDAPTRIGLGEGEGEEGGQMTDVVVVRQEIEQCRTALEAYLSSRSGQAA
TGDHRAELMMAELAEKWERIKNLASAHERDLEAAANERTERLHGELASFTSWLSAAEQWA
VEPAPISRLPEGLAAQRLQQQERMAEIEMRSTALAATLSLAREVETGDRDAPDGAQLAGQ
PEATTLSLMAGGHDGAACAPPQAAAAKQAVNLEERLTRLQLAARERSEHLATASEATTAW
ADGVTSINDWMETVERNTEVALPLTLNVSRLRVALEDAKSTIADVSSHRVQFEMTKKRAV
ALMEMATDSEKGEIEWRMEALRKRWEGVSATVDSRCAEAEKAAAEDQLLGSFTGNVMAVR
FRKFSTDASSTNYHYSLIKERGLPMYAASLVAAGVEQAATIAAAAARLEGKWKEMEDEGA
RRKDELERAMEEAKNCDEKVCSLLMWLGNLEEQLDVPSSSDLSTGLAAVGSVRAALSVER
PRLQSVSEACEALLDGCHPAAEQAIQEWRRVIQGKWKQVEDRAAAKEESMIEEEERQRAN
EAAMDEERRAVEEHLAEVAQQTVAWHGEVHALEEWMEKAESKMAVAPAMTVDGDRLRETL
QEAKSTAVDIASRKYEFDLMRGRAGVLMQIAPENERKEIEETDEALGKRWDAMCAAIDSR
CAEIEKSAAESGAFTEALANLEEWLDGELAEGAVRKEKGCRGDVDTVANMLSAERNREHA
RKDKAESIEAIRMKAASLVAAGVDGAAAVAAAAAALGDKWAAIEGEGARRREELERAMDE
AKECDAKVYGLLGWLVDLEEGLEVPAPSDRSAQLDAAGSVRAALAAERPRLEEVKEACEA
LLVVCHPDAEQALKEWRRVVEARWREVDDQAAAREESLLEEEKQRANEMAMDAAREFEER
KRLELDESRWEAESVGEEIDQCADEVLASLETRKPLPGVPETAEEQMDEFMAVKAAIEQT
RIAIEDYLSRTIEAASADEENWLRRNRARLEAKWGRIKVDLRAWLQWAEQSLAEAGPISR
LPAGLATQREEQEERMEEVDRRRASFLDTKSLAGQIRAACEAKDAVYIKNQTVTLDAKLA
KFVGRAGERSKQLEAASHETAAWLEGVNSLDDWMEEIKSKTAVVPPTTSDVDRLRKALEE
AKTTVADVCAHRTHFEHVRRAGVALMEHAPKHERSEIETEIGEFRKRWDAVCAAADSRCA
EAEQALLEGKLFIDLLKREIPGSGAFTEALANLEEWLDGELAEGAVRKEKGCRGDVDTVT
ELVYADRKREEARRKKAETIGAITKKAASLVAEGVEEAAAISAAAARLEGKWKEMEKEGK
SRKGELERAIVEARDYDGKLTLFW
Download sequence
Identical sequences H3FZF7
PPA27706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]