SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA27797 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA27797
Domain Number 1 Region: 11-239
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.12e-65
Family BAR domain 0.000000677
Further Details:      
 
Domain Number 2 Region: 316-381
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA27797   Protein: PP19161   Gene: WBGene00117351
Sequence length 389
Comment PP19161 WBGene00117351 locus:Ppa-unc-57 status:Predicted
Sequence
MSLSGLRKQFNKANQYLSETMGAAEPTKLDDEFNEMERKVDVTYELITNMVAGVSEYLQP
NPATRAKMATMGAISKVRGTTKNAPYPQTEGMLAETMTNYGKKLGEDSDLGKALVDSGEA
YRQCADIKYQMEDTIKRNFVDPLTHMQNNELKDVNHHRTKLKGRRLDYDCKKRKQTRDDE
LIQAEEKLEESKKLAEMAIFNVLSNDIEQISQLSALVDAQLDFHRQTSQVLEMLQTQLKG
RIKEASCKPRTDHNPKPVLDMRTPRSRSPAPDGMNSGFDAPPSYASNGGGAAAAAPSWTP
AAAQMPPPKSAHQPAAPVSHAPKAAAKALFDFDAQNEGELDFKEGDMIELITQVDENWFE
GRNVSSGKAGLFPCSYVQKLTAICDYSLP
Download sequence
Identical sequences H3FZP8
PPA27797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]