SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA00457 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA00457
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-28
Family SH2 domain 0.00058
Further Details:      
 
Domain Number 2 Region: 106-153
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000761
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA00457   Protein: PP04756   Gene: WBGene00090011
Sequence length 161
Comment PP04756 WBGene00090011 status:Predicted
Sequence
MDDYVNTEVTAQEWYMGELSREESEARLRGTPNGMYLVRFSPKKHQYVISISYAGEVKHT
VIENPTAATYYLDETTTFPSIVELINYYRENNLRESFNALDTKLTKPHRECKTFRANHPY
KATEPKFLELRVGDLITLVDTMGEERGWWKGKIGERITENQ
Download sequence
Identical sequences H3DSS6
PPA00457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]