SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA09639 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA09639
Domain Number 1 Region: 8-87
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-20
Family SH3-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA09639   Protein: PP21872   Gene: WBGene00099193
Sequence length 91
Comment PP21872 WBGene00099193 status:Predicted
Sequence
METIAHRDAAEELEKAKFKKAAFSIQANSDFDGSLEVDPPLPGRVISYKAKDGLEIMEKY
NDEWWIGKKDGELGFIPSPIKLQSLRKQAQN
Download sequence
Identical sequences H3EIR9
PPA09639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]