SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA13867 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA13867
Domain Number 1 Region: 6-78
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-18
Family Spectrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 181-267
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-18
Family Spectrin repeat 0.00027
Further Details:      
 
Weak hits

Sequence:  PPA13867
Domain Number - Region: 74-102
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000907
Family Spectrin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA13867   Protein: PP12013   Gene: WBGene00103421
Sequence length 267
Comment PP12013 WBGene00103421 status:Predicted
Sequence
EDPTGDNVESLIKKHEDFDKAITNQQEKMNALKQFANQLIANGHYDAGAVARKQDEIQRR
WDQLKDALIDKRSKLGESQTLQQFSRDADEIENWIAEKFQVCGVVTGKGRPVEKATEKEI
GKRRPPSQIAQEENYRDPTHIQQKHQKQQAFEAELAANSDRIQTLINAGQNLIDASKCQG
GEDAVSARLRALNEQWELLVNTTKEKSFRLKEANKQKSFMAAVKDLEFWLGEVEILLRSE
DYGKDLASIENLLKKQQLIEADIDAHK
Download sequence
Identical sequences H3EVM4
PPA13867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]