SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA14947 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA14947
Domain Number 1 Region: 359-505
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000849
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 2 Region: 190-278
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000903
Family Spectrin repeat 0.006
Further Details:      
 
Weak hits

Sequence:  PPA14947
Domain Number - Region: 286-405
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000736
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number - Region: 488-573
Classification Level Classification E-value
Superfamily Spectrin repeat 0.036
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA14947   Protein: PP10590   Gene: WBGene00104501
Sequence length 612
Comment PP10590 WBGene00104501 status:Partially_confirmed
Sequence
MEISKYRDRLLTDTVFLPGSRDVWGGPLLIVVPPQTIASVTPSVEEGTDLPLGYSQLVPC
VSIHKLTKFVQIGSLPEVFGGVYGYEVKEWIKTRERVEKMNRDLESVLSGLNIEKATRLN
ETHEKILKSGEELANELSTCSSNEDDHHWAIVIRRLVAQCYDVLSEPERRAKVKEEIDAT
RLADCQTAQMNGLLDWLEGVGETWLLSIREIGESRDEARQLMKQHDQLRTKVQELEAQTE
QLDDMGTKLIEVLPNHAAVLDKSRNHLKHVVSQFSARVQRGMEMAEKSENFHDKMNLFTR
RADSLLDALCSESSANESSSAIAQRTKMEEEVEQLKSAYDDLKATGGEFIQDLASNEISP
FGKKACRDYGPGIYHIREQLDSANERRRRCLDLVDVRLLRLQHVIQLFTCERDAEQSIEW
LSEMKNTLDNQYLQIEYSQDEVDHLREDYTKLEAAARSTYDYGKDLCQVALVLRRSLRME
QKQGVSTEDKLEQICTQLCRSLSEKDARLAMTEAYIGTMKTVEEQLEMVEQKGKAMDKDR
PAKHAYLSADRRRISSQLADLKHLGEAICGHINNQTSLPAEIRSGKMRTISEKVDNLNRK
QQEVEKLFVENE
Download sequence
Identical sequences H3EYN4
PPA14947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]