SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA17273 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA17273
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-17
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA17273   Protein: PP13155   Gene: WBGene00106827
Sequence length 81
Comment PP13155 WBGene00106827 status:Predicted
Sequence
MPRQVQAEFDFEAQPGTSELNLTAGEILTVLQDNVEGGWVEGKNARGKIGLFPATYVIPY
SGPSGKNRETSIEIGDLLCVP
Download sequence
Identical sequences H3F549
PPA17273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]