SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA23436 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA23436
Domain Number 1 Region: 49-122
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000499
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA23436   Protein: PP13634   Gene: WBGene00112990
Sequence length 169
Comment PP13634 WBGene00112990 locus:Ppa-prx-13 status:Predicted
Sequence
MLAGHSTAGPSMNWPAAMFWLVALGGPYLIYKSITSMVAEAEKKRQWAVGTGSHYSAVTL
FDFQGSSDQELSFMANESLRVAPKEEQPRMRGWLLASSKEGDRIGLVPINYVRIISRQST
SPPPTAESTSLDNLNRAFHSGMTPHRTVSPRNQSISHEFRKSWEENNLE
Download sequence
Identical sequences H3FMD0
PPA23436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]