SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA25852 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA25852
Domain Number 1 Region: 54-80
Classification Level Classification E-value
Superfamily SH3-domain 0.0000147
Family SH3-domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA25852   Protein: PP15181   Gene: WBGene00115406
Sequence length 80
Comment PP15181 WBGene00115406 status:Partially_confirmed
Sequence
MQNMPANVTPSPSIEKILEEPNASSPPSMTSLQSPTRNGHTIVEGVTDSDEPVLCVCAAQ
FPWKARNTGDLSFGKGDQIE
Download sequence
Identical sequences H3FU72
PPA25852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]