SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA27260 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA27260
Domain Number 1 Region: 409-602
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.1e-48
Family Nucleotide and nucleoside kinases 0.00000354
Further Details:      
 
Domain Number 2 Region: 143-236
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-24
Family PDZ domain 0.00075
Further Details:      
 
Domain Number 3 Region: 254-348,406-437
Classification Level Classification E-value
Superfamily SH3-domain 2.26e-21
Family SH3-domain 0.00035
Further Details:      
 
Domain Number 4 Region: 29-94
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-19
Family PDZ domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA27260   Protein: PP26706   Gene: WBGene00116814
Sequence length 607
Comment PP26706 WBGene00116814 locus:Ppa-dlg-1 status:Predicted
Sequence
MLRKWNWARRLALTEDERWDKLIMEWTPIDRDSGIYVTKIIENSAAAHDGRLRVGDRIVA
VDETSLENVAHEYAVNVLKNTGTRVQLLYVKNPHPEVNFGENTSFGMNSTPNRPGSVHGY
GDRSFESSHQPYAPQETPVYQPHQMEIPLHPRKTALVKGTQGLGFNIVGGEEGEPIYISY
VLPGGVADLSGQGDVLLEVNGVSLHSATHGQAAECLKNATNPVTLGLHYRPQEYQEFEDK
IERLRADLIRNNTPAAVMPKQLYVKALFDNEPSREDGAPHRAMAFNYGEILHITNDTDPD
WWNARKVADNGDEGPEGVIPSKRRVEKREKQRRKRVNVRSPDEISGSQSLGRGATMAGGL
EGRRGSKSQLSFSRKFPFVKSTDRLNEMTDQELSVTDEPVHSYVPVDQQQRTYVRPVIVL
GALKDKINDELVTRHPERFGSCVPHTSRQPRDSEVHGRDYHFVSKEQMEVDVRNNLFIEA
GQFQNNLYGTSIASVKEVAQQGRHCILDVSGNAIRRLQSIANIHPIAVFVKPQSPAQIMD
WERGQMNEDEAHAQFQRCQRIEQSFGDLFTQVISNAHSFEEIVQRVLHTISVESRPTIWV
PNPARPL
Download sequence
Identical sequences H3FY66
PPA27260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]