SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA27697 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA27697
Domain Number 1 Region: 16-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.67e-32
Family Calponin-homology domain, CH-domain 0.0000278
Further Details:      
 
Domain Number 2 Region: 998-1118,1151-1176
Classification Level Classification E-value
Superfamily Spectrin repeat 3.03e-16
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 3 Region: 523-653,714-738
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-16
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 4 Region: 131-238
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000368
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 376-468
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000785
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 6 Region: 817-925
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000101
Family Spectrin repeat 0.0047
Further Details:      
 
Weak hits

Sequence:  PPA27697
Domain Number - Region: 217-342
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00288
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number - Region: 653-704
Classification Level Classification E-value
Superfamily SH3-domain 0.019
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA27697   Protein: PP16418   Gene: WBGene00117251
Sequence length 1206
Comment PP16418 WBGene00117251 status:Predicted
Sequence
MDLPGTPHAPLDALEGGSAKDALLAWAQRATEGYPRVRVSNFTNSWRDGLAFNAILHRYR
PKAIDWEQISDPSVSNRERLANAFEVAKREFDVDKLLDPEDVDRDTPDEKSIITYVSSLY
QNLPNLPEASKMHQLVADYEHEATEWRRWVEKMIDLVDDRLLIGSADALIDELQRFKEED
MPPRATDLSRLLEIYAELERRLPPGTAFASEPLQPSPMKRLWSDLCDAVERREQLLLQRR
ATQGSLADLTSRLTRAIGIINEKLDLILIRIEDVESRVDSASPAEIERIVNGIVDDLNAL
ESPIAICFEDVEQLKQHRHPDANDFYRQVLGLHQRRNAYLDRLNNQLLVRLGVRTETMRR
QQMEQSESARRSRFGRVEECIQWVRTRMEHLVNMEFSQALEKLEEMFSKHKLDNHEIQDF
RQEVDMCIARQSEITAEDSVEYCELLSVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQME
LVWVSEREEIEVHRNWSDINQLDLPMLSNYYKQLLHEMELREPQYNEVHNRGAALLNQGH
PAIQVIEVYIQTLKKQWDWLLNLSRCLEEHLRDANNLKSFMEEAAEVEVKIREYTEILER
NYNKTDFSLDEGERMLQELDNLKEHLNGIQSVIHKLSERCATISPLWQRGERISKNMLVT
ALCDYEDAHVNIRAGDDVILLDNGDLVHWKIQDVMGKQGIVPSVVFRIPPPDTRLTAWLT
RLLQQFEKLRKLWDLKHRMIRFYMVLNTMKTIQGWDVNMFNSLDPDQRDAIIRALQDDTN
KLLSELDPNDPLAQRLRDELKKTMDHFWSLFNQAQRQPEEDLSNEFDRMMADLLRKLEDA
WRALKERTGRPVPRTAEELERALKEQREFEDMLQSLDGDVNNLKAIFSQMTNPSPSQRHN
MDRVNVLWDDSWDLSKMYVERMKVLDMVLAGIIEVKDIVRAHEVTLNSFDDLPCALDKLR
GEHAQLVELNMVLKQQQTLFDQLNHNVSLLRQHVARTRLDTSTHPDVDRLEEEVQHLNNR
WENVQTQLTERLRITELALQIQMVYRGEYENEMAWLDRVEDTINKLRKPEELRPEQYQQQ
LDLLVAEYAQLQERTAAIENVNREGGKYIREAKGYDGRLKQYGDAIRGIHGRDIEREFKR
THPQPKNGAQIVTEELEALNRRFAQLSSLILEKRNVMQVLIQNWKREKQSEINLNDSCSY
PTFPQQ
Download sequence
Identical sequences H3FZE8
PPA27697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]