SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PPA27704 from Pristionchus pacificus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PPA27704
Domain Number 1 Region: 126-280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000504
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 2 Region: 17-171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000125
Family Spectrin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: PPA27704   Protein: PP18693   Gene: WBGene00117258
Sequence length 301
Comment PP18693 WBGene00117258 status:Partially_confirmed
Sequence
MVIELAAAISAQRALLDRFDKDVNALQALAHPEDAEHLEEIRGDIVARVEEIKQNVQERG
AALDSVMDVSSALGERLDAMHAALAAEAARLRLDEPLTADMTALESRVADARSQKDGLRQ
KEPLMDSLRERIHDVMGTGDASAQELVGKMDQLEKLWSELGRGAELKEQLLTDALGKAKR
FWGDLDTCERAVDDLKRRLDAIEPCVGQPEVIQAQTADLELIAEAVDSVPPMVDELRVAG
RELSKIVPGDEKAAISSRIDNVEADAATITTLCAQRYGDLGRALEEDGVNNSHEVYSHRI
I
Download sequence
Identical sequences H3FZF5
PPA27704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]