SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374294576|ref|YP_005044767.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374294576|ref|YP_005044767.1|
Domain Number 1 Region: 337-475
Classification Level Classification E-value
Superfamily AbfB domain 2.88e-45
Family AbfB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 82-289
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.42e-24
Family alpha-L-arabinanase-like 0.016
Further Details:      
 
Domain Number 3 Region: 497-567
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000167
Family Type I dockerin domain 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|374294576|ref|YP_005044767.1|
Domain Number - Region: 37-101
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 0.000314
Family Glycosyl hydrolases family 32 N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374294576|ref|YP_005044767.1|
Sequence length 569
Comment beta-xylosidase [Clostridium clariflavum DSM 19732]
Sequence
MYNSLKRVLGTLIIFSLVAVMLAVNTYIFAEEPYTAYLFVHFTGESANGEQTYFSVSKDG
LHWTDLNNSAPVLISDVGEKGVRDQSIIRSVDGSKYWILATDLRIASGKGWNAAQYNGSK
SIVIWESTDLINWSSPRLVNVAWNIPSAGCVWAPEAIYDEETGNYVVYWATISPLNGVTK
ARIYYCTTKDFITFSEAKLYIDRPGNQGIIDTQILKVNGKYKYIRASRDGQITLEGSNSI
LGNWTYIGDISHLGYTEAQVEGPILYKFNNENRWGLMVDQYASNKGYLPLVTNDLTSTAN
FRVLSSGEYFLGANRKRHGSIINITEEQYNALVSKWPSEPSSRIQSYNYPDRFVRHINFD
VRIDSDINPFADSMWKIVPGLANPSGYVSFEAVNYPGYYLRHYNYDFELAKDDGTVTFKE
DATFKIVPGLKDSTWVSFQSYNYPNRYIRHYGYLLKLEEISTDIDKQDATFKIVDFGLDI
STPKPSQDIPTPTPAQSVLCGDVNDDGQRNAIDYALIKTYLLGIIKEFPSPKGLTAADVN
GDTRVDSIDFAMYKQFLLGMIKVFPAEAM
Download sequence
Identical sequences G8LZI0
WP_014253481.1.34793 gi|374294576|ref|YP_005044767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]