SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374294819|ref|YP_005045010.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374294819|ref|YP_005045010.1|
Domain Number 1 Region: 29-378
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.33e-89
Family beta-glycanases 0.000000182
Further Details:      
 
Domain Number 2 Region: 601-817
Classification Level Classification E-value
Superfamily SGNH hydrolase 4.43e-24
Family BT2961-like 0.078
Further Details:      
 
Domain Number 3 Region: 407-479
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.73e-18
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374294819|ref|YP_005045010.1|
Sequence length 818
Comment endoglucanase [Clostridium clariflavum DSM 19732]
Sequence
MYIKQFIRKQALLFSLILVITSLLGSINVFASTAYTGMRDISALELTREMRVGWNLGNTL
DAFSSSASGLDTETCWGNPKTTKAMIDKIKEMGFNTVRIPVTWSGHVGPAPNYTIDSAWL
DRVEEVVNYVLDNDMYAIINLHHEESSWLIPTYSNQQNVTAQLTKLWEQIANRFKNYSDY
LIFETMNEPRVVGSPNEWTGGTYENRAVINSLNAAAVNTIRSTGGNNAKRFIMIPTHAAS
SITEAMNDLVIPNNDSRVIVSIHMYSPYYFAMVANATATWGSNSDKASLSSELDAIYNKF
IKNGRAVVIGEFGTIDKNNLSSRVAHAEYYASEARKRGIPVIWWDNGYYGPGNGDSYAIF
NRRALTWYYPEIAQALVRASGYTGPTTTPTTIITPTPTATPVPTPTTSYVYGDVDGNDIV
NSIDYAYIKQYLLGMITEFPGANGMHNADVDGSGSINSIDFAYVKQYLLGMISKFPAEEN
ASATPTPGSNATPGILYNGRFSTSNPAGPICAWSGSNVELNFYGTEVSATIRSTGENWFQ
AFIDGVGQTPFCVNNTTLTVKLASGLSEGNHHLLLWKRTEASQGEAQFLGFDFGSGKLLN
PPAPKERKIEFIGDSITCAYGNEGLSKEQSFTPKNENSYMSYAAITARNLNASANLIAWS
GIGVCRNYGGAAGPLMGERYLYTLPYSNVKWDFKNYIPQVVVINLGTNDYSTAIPDNATF
INAYRDLLSTVRSNYPDAHIFCAVGPMLWGTGLEVCRNNIKSIVNSLNQTGDSKVYFIEF
PQQDGSNGYGEDWHPSIKTHELMAEQLTKAIQEKLGWY
Download sequence
Identical sequences G8M2L2
WP_014253718.1.34793 WP_014253718.1.85326 gi|374294819|ref|YP_005045010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]