SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374294824|ref|YP_005045015.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374294824|ref|YP_005045015.1|
Domain Number 1 Region: 156-231,329-454
Classification Level Classification E-value
Superfamily L domain-like 1.96e-29
Family Internalin LRR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 42-105
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000128
Family Type I dockerin domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374294824|ref|YP_005045015.1|
Sequence length 456
Comment Leucine Rich Repeat (LRR)-containing protein,dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MKKSISLLLVFCVIACFSLFRLIADNSYACELCEARKYLPDRVVGDLNLDGEINSVDCVI
MKAYLLGIYTNLENDKERFGAADINSDGNVNSIDYAILRKYLLGMGELPTPSPKPMPSVT
PTPRIITESGYEFNLDTGTIVKCVDNYVTVTIPSELRGVKVKAIGDKAFSSCKYLTSLTI
SEGISCIGSEAFSGCENLVSVTLPNSINCIDSNAFEGCKELKKAIFMGNEPEYMGNNVFA
DVHPDFTIIVSADSAGFGKPNPYNSETLWEWSVNSNPVYNVVLAEDEIIVFKSEYLRLVI
LDKIGKNEYDIIYKNEADKITELSLFKPIDLSELSKFPNLDYLSIGLISEPFDISPLANL
KNLTRLDIFDSDISDISPLKNLTNLTYLSLSYNNISDISPLENLTNLAYLKLDCNNITDI
TPLKNLVSLKSLDIRGNNIEDLTPLEKLNELIWLYY
Download sequence
Identical sequences G8M2L7
gi|374294824|ref|YP_005045015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]