SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374294869|ref|YP_005045060.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374294869|ref|YP_005045060.1|
Domain Number 1 Region: 4-47
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000000526
Family CopG-like 0.018
Further Details:      
 
Domain Number 2 Region: 37-89
Classification Level Classification E-value
Superfamily HMG-box 0.0000824
Family HMG-box 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374294869|ref|YP_005045060.1|
Sequence length 92
Comment putative transcriptional regulator with CopG/Arc/MetJ DNA-binding domain and metal-binding domain [Clostridium clariflavum DSM 19732]
Sequence
MAQLKKILISLPDNLLKEVDSIVAMERINRSEFVREAMKLYIREKRKIEMRDRMKKGYQQ
MAEINKKLAEIWFEADNEQQQKYEEGLRELEK
Download sequence
Identical sequences G8M2R2
WP_014253768.1.34793 WP_014253768.1.85326 gi|374294869|ref|YP_005045060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]