SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374294924|ref|YP_005045115.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374294924|ref|YP_005045115.1|
Domain Number 1 Region: 1647-1714
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.67e-17
Family Type I dockerin domain 0.001
Further Details:      
 
Weak hits

Sequence:  gi|374294924|ref|YP_005045115.1|
Domain Number - Region: 905-1001
Classification Level Classification E-value
Superfamily E set domains 0.0196
Family Arrestin/Vps26-like 0.018
Further Details:      
 
Domain Number - Region: 1296-1364
Classification Level Classification E-value
Superfamily TPR-like 0.0607
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374294924|ref|YP_005045115.1|
Sequence length 1717
Comment large extracellular alpha-helical protein [Clostridium clariflavum DSM 19732]
Sequence
MFKKAMVVIVIVTMLVSIMTSSFASGIEAYPKNGFRLVAQDSDSTGIAVDSEFLLETEKD
YSLEEIRNVFSIDGEPAPIIEELDKNFFSIKLARPLMENSLYTFRIKTDKETTWMFQTQS
TFKITGTLPAEKSVNVPVNTGIEINFSHENFTDFKEHFEITPTVKGKFEIHKKTAVFVPE
RLEYDTVYTVRIKKGIKLQGTNRELTEDYVFSFETESKNANATPSPDEITANIYTGRYLY
DFASDEIPEVLVTYSIQNRRLTPVEIKAQMSIYAYKDFDSFFDAVKDKNTTPYWARSYIK
KFVPVDNLQKVLDFEQVLNEDNSRTYGQTYIKLPQKLPEGYYILDGTWKDVRFQTFLQIT
NTGIYIAESNTKTLVWLNDLSTQKPIEGASIRFVGYDNVQYSGNDGVAFFESIGVPDQNN
NIIFDLYAYNRYNKFMIVTTKEGKSSVLDCSSNVYFNENKYWTYFYTDRNMYKSDDTVNI
WGFVKNRYSDEPIDYLTLELNSNRYDNSTPIIKQTLQLNNSFFEASINLPNLPEGYYYIT
LKKGDKLIINQYLRIKNYTKPSYKLEITKDKEAIFVDEQATFNIKAAFFEGTGVSDVNIT
YYVNAYQLNGNIASTTKKADLKGNLSVQYSPTAGDNVQGVRTAIINARATLPESGLIDAS
DYLQVFINDINIQGDAKIKDGKATVTAKVNKIDLERINNGTAENSYDYLGEPVANQKING
SIYKNTWIKTETGTYYDYINKTTYKSYSYKLQKEFMGDFSMTTSSDGTASYSFNAPELQD
GYYTVEISSIDRNGRKISNTLYCGKVYDYSIYNNPIYTLEVNKDSYRLGERVDVSFKYGG
QPLPEGSYLYFKAQNGIYDYDTVTSSSYSFNFSEEDIPNTAVYAVYFNSKTYVFRSISVN
YDIQEKNLTIQASTDKDFYKPGENVTVYFNINDLDGNPVKSTVNISVVDEAFFYLQDQNV
DLLKTLYTYVGSGVYFEGRSHTLEKNQDYYDYNGRVLLPADAASGGGSGENKSEPTVRED
FKDTAKFITIQTDDKGRGQATFKLPDNITSWRVTLSAISEDLHAGSDKTNIIVTLPFFIN
YSFNTTYLEGDKPILGVNAYGNGLEENDEITFEVISSDDSNPKLTVKGKAFERINIPLWT
LKEGQQDIIIKAYSDKSYSDAVKHSFNVVKSYYQIEKAVYYDVKPNMTITSGNSGYTSLV
FQDKSSGMYLSDLLSLRYSYGNRIDQIVSNYTASSLIEEYFKDVYSDYELPKPSLADYQK
SNGGLSLLPYSESDLELSAKLTSLVKSMVNTKLLKDYFYNNLGSTSASDKVKALYGLSVF
KEPVLLELEEVAKIDNLSVKDLIYLALAYCELGDVSTAELIYKNRIYPNIEKFEPYYRVN
VEKDKDDILEVTSLCAYLAAKINAPESEGLYEYCLRNYTKDILIGIEKLMYISTVLENQE
PKEGKITYSLAGETKTVTVSNGSSHCISLLPSQLEDFRVVDVEGIVSVVSIFKEDVLDIN
KKDDEISIKRTYYYSNGFPLTSNTLKQGDIIKVRLEWNISNTAFDGTYMITDYLPSGLKP
YNSYWNTEGQMIRFYAYNRSPVRYIEYYARVISPGTYTAQGPIIQGLASRDNINIGKTET
VTIEATEPILTPVEDLPEPTPTPVENILYGDVNGDNEVNSIDFAYMKMYLLGITNKLPMD
AKYGDLNGDGYVDSIDLALIKMYLLGYIKKFPVESMN
Download sequence
Identical sequences G8LSD0
gi|374294924|ref|YP_005045115.1| WP_014253823.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]