SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295312|ref|YP_005045503.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295312|ref|YP_005045503.1|
Domain Number 1 Region: 178-487
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-57
Family beta-glycanases 0.00019
Further Details:      
 
Domain Number 2 Region: 524-589
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.96e-16
Family Type I dockerin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 34-164
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000272
Family F-box associated region, FBA 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374295312|ref|YP_005045503.1|
Sequence length 590
Comment beta-mannanase [Clostridium clariflavum DSM 19732]
Sequence
MKIFFSRGLSLLATIAIVFSILLSVPASVNASNSLPVKVEAEDCILSNGATITTNVYGTE
YPGYSGEGFVWVANSGTITLKVTVPENAMYELSTRCWMYLGKENETRLQAVSINGKPLGN
FFIPNKGKWIDYSFGFFYLEAGTTTIEIGTSGSWGFILYDTITFDYADMPELKIDPILSD
KNATPETKKLFEYLTSVYGKYVISGQQEIYGNGNNGNMELEFEYIYDKTGKYPAIRGFDF
MNYNPLYGWEDGTTERIIDWVKNRGGIATACWHINVPVDFANYKLGEFVDWTKCTYKPTA
SFNTAKCLDKTSKEHAYLMMAIEDLAEQLLILQEAKVPVLFRPFHEAEGYNNIDGSGAWF
WWGSAGAEVYKELWKLLYKTLTEDYGIHNLIWEVNLYTYANSYEWYPGDEYVDIIGYDKY
EGSPTNWGTSAASSLFLTLVNYTNDTKMVALTENDVIPDIQNIVNESAWWLYFCPWYGEY
LMNRNDPVLLNTIYNSEYVITLDELPKDLYDTGNYTPTPTPQKRIVGDLNSDGKFDSIDI
ALLKSHILGIETFNIDLTYADVNADGDINSIDYAYMKQRILGMISKFPIE
Download sequence
Identical sequences G8LWF3
WP_014254201.1.34793 gi|374295312|ref|YP_005045503.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]