SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295334|ref|YP_005045525.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295334|ref|YP_005045525.1|
Domain Number 1 Region: 270-576
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.98e-67
Family Pectin methylesterase 0.0000112
Further Details:      
 
Domain Number 2 Region: 114-237
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.14e-25
Family Family 6 carbohydrate binding module, CBM6 0.029
Further Details:      
 
Domain Number 3 Region: 31-101
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.57e-17
Family Type I dockerin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374295334|ref|YP_005045525.1|
Sequence length 581
Comment pectin methylesterase [Clostridium clariflavum DSM 19732]
Sequence
MMKRLLVLLIVLGMAFSIYPNSGLAADDVSAMYGDLNGDGSVNSIDYAIMKSYLIGIRSN
FPVLNGEVVGDVNADNSVNSIDYAFIKSYLLGLISEFPAEKTRPLTTPAPQEEAIYEAED
AALYNSFLETIHSGFSGSGYVNYNNEYGSYVEWKVNVAKNGAYKLIFRYANGANTNRAMS
ISVNKKIARNSLDFNPTGSWTGWSESYIVVKLDQGDNLIRATAITADGGPNVDYLKVMST
NEPVMTPDPTTAQTPAPTPKNETPVPSSSTTIPAGAIIVDKSGRGNYTTVQAAVNSLGSK
SSDAKTIYIKNGNYKEVVTIPNGISNLTIIGESKENVIIHYDNYNGKSNGSGGTYGTSGS
ASVFIKGSDITVHNITFMNSFEEKGNSNEQAVALSATGNRIKFNNCIFRGNQDTLLCDGG
TQYFYKCLIEGDVDFIFGRSQAVFEECEIRSLNRGSKTNNGYITAARTDASAPYGFVFIN
CRLTCEWGTAANSVWLGRPWCPNGTDVNKPAVAYINCYMDAHIKTEGWTSMSGVDPSHGR
FYEYNSWGSGAAKNSSRPQLTAAQAANYTKINVLGGWNPSF
Download sequence
Identical sequences G8LWH5
gi|374295334|ref|YP_005045525.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]