SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295461|ref|YP_005045652.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295461|ref|YP_005045652.1|
Domain Number 1 Region: 26-91
Classification Level Classification E-value
Superfamily Type I dockerin domain 9.52e-18
Family Type I dockerin domain 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|374295461|ref|YP_005045652.1|
Domain Number - Region: 108-527
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0439
Family Pectate lyase-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374295461|ref|YP_005045652.1|
Sequence length 566
Comment hypothetical protein [Clostridium clariflavum DSM 19732]
Sequence
MVKKWFLSMAVLLTFVANSFITSYAAVRGDLNNDNRVDSLDYAFYKMYLLGSYHLSDISV
ADLNGDGDTNSIDYAILKQYLLGMIKEFPADANPTPTPSSDPKKDWENNKGTINLGSTIT
YTGEGISVNGSTVMITSGGDHTVTGTLTNGMIYINTKERVKLRLSGVNITNSSGPAIFFE
DVDKGFITIVEGTVNYLTDGRNYNVDAKATLFSNDDLEIKGKGTLNITANYNHAIASDDD
INIENGTINIISAANDGIHANGSIDITGGTLNITATGDCLQTEEEELRIEDGKLTLSAGS
QALKSDIGVVISGGTVNVVKAKEGIEAPNITINGGTINIESEDDCINASMSVDAMFNSDG
SQLIINGGTIYASATIGDAVDSNGDFTMNGGTLVVHGPQSQPEVAIDVNGNFTVKGGTLI
AVGPSPLMAQYPTGASSQYSIAAMFNSTQPANSALCIKDSTGKVLAITRPKRNYIYVVFS
SPELRQGSTYTIYSGGNVSGGTEQNGLIVGGTYNGGTELATITVTNSPTTAVNWNSGFFP
GGGFPGGGFPGGGFPGGGGGFPGWGW
Download sequence
Identical sequences G8LXL7
gi|374295461|ref|YP_005045652.1| WP_014254346.1.34793 WP_014254346.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]