SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295465|ref|YP_005045656.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295465|ref|YP_005045656.1|
Domain Number 1 Region: 41-394
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 9.78e-96
Family Cellulases catalytic domain 0.000000000522
Further Details:      
 
Domain Number 2 Region: 418-480
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000334
Family Type I dockerin domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374295465|ref|YP_005045656.1|
Sequence length 483
Comment endoglucanase Y [Clostridium clariflavum DSM 19732]
Sequence
MRKKYKIKLLRRGIILLTLVSLMVSTVFINTGSVSAAKFPYNAVYKYGLSSVVDNQDEAN
ALLLREWEAWKSRHITSNGAGGYKRVQRDSSTNFDTVSEGMGYGMLLAVYFNEQSLFDDL
YRYVKLHFNSRGLMSWHINPDGSLPDSGSYNCATDADEDIAVALIFAHKQWGSNGSINYA
NEARNLISNLERYCLDGDILKPGDVWGGWSTVNPSYFAPAWYKIFAQFTGNSKWYSVADK
CYEIIDNVHRRNNGTGLVPDWCQGDGAPASGMGYNYSYDATRYPWRTVLDYLWFGDQRAK
NNCDLINKFFIKIGPENIRGEYSITGNQIGSAHNSSFVAPIAASALTGYDLNFAKAMHEE
NVKVTEPPEYCYYGGTLRLITMLYTTGNFPNLYEEVISRTPTPTVPTPTPTPSNGGTVIK
GDVNGDGEVNSIDYALMKSKILGLIYNFPYIYGDLAADMNDDGDFNSLDYALLKMKLLGL
TSI
Download sequence
Identical sequences G8LXM1
gi|374295465|ref|YP_005045656.1| WP_014254350.1.34793 WP_014254350.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]