SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295470|ref|YP_005045661.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295470|ref|YP_005045661.1|
Domain Number 1 Region: 61-147
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.00000000000000445
Family Lamin A/C globular tail domain 0.012
Further Details:      
 
Domain Number 2 Region: 886-951
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000471
Family Type I dockerin domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374295470|ref|YP_005045661.1|
Sequence length 952
Comment dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MNKGISIFFVVVLLLLAIIPTEAVIVSAQNQVLFINEVMASNSQTIRDGDIDDKKEGSNG
GAYSDWIEIYNSGDQPVNLTGYTLSDSEATWTFPNCVIQARGYLIVWASDKDKVAKNGQL
HTNFKLSASGEEVILKDPNGNVVDYVKFESLSDDQSYGRKTDGSSQFVIFTKSTPGYSNA
MGSIQVKEPVFSKVGGFYTDAFDLEITSDDSEVEIYYTTDGSDPVPGNSGTKQYTGKIRI
ASRAGEANVLSMFRDVSTDFANPWRAPNGEVFKCTTLKAVAVRRDGSRSKVVTHSYFVDP
GIKTRYTLPVISVVTDYNNLFDPQIGIYHASNAEKSGEEWERPAHIEFFEPGGKLGFSQN
IGLRIHGGYTRKFPQKSFRIYADGKYGDLGEFKYEIFPGLTKRVNDKKMKNFERLILRQA
GNDWSSAYMRDEVLQSLLSHIKTLDTQAARPAILFLNGEYWGIYYVRERYDKEYLKEHYN
LDDKKVAILEPTQTISVEYGTQEDADAYTNEVINYLKSNSITQTSTYEYIKTKIDIDNYI
VYNIAEIFFGNTDWPGNNVTIWRYKTDDGQYHPEAPYGQDGRWRWMLKDVDFGFGLYNKP
VNHDTLSYAAGDRVEGTGNPEWSTFLFRTLLQNTEFRNQFINTFADHLNTTFVPERVIEV
INNFESILSPEMTEHANRWTNIKMTASNPGNPGGGNPGWGNPIGGNPGWGDPTGGNPGWG
NPIGENPGWGNPIGGIPTWGGETTWSQNVQVLKDYARNRPSYMIQFIRNKFSSNGVTGTA
NITLNTDPSKGYIKINTIDIKSSTPGVKDPSRWTGLYFTGIPVTITAVPQEGYVFDHWEG
IAGYSDTVTFTHTGDINITAVFRKDTGATPTPVVTPTNTGLPGKGIIGDANWDGDFNSID
IGLVKMYLLGMINENGINVKACDVNADGEVNSIDFAFMKQKMLGMIDKFPAE
Download sequence
Identical sequences G8LXM6
WP_014254355.1.34793 gi|374295470|ref|YP_005045661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]