SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295530|ref|YP_005045721.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295530|ref|YP_005045721.1|
Domain Number 1 Region: 45-423
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.92e-79
Family beta-glycanases 0.00000113
Further Details:      
 
Domain Number 2 Region: 467-536
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000177
Family Type I dockerin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374295530|ref|YP_005045721.1|
Sequence length 537
Comment endoglucanase [Clostridium clariflavum DSM 19732]
Sequence
MKSRCMKKALSIILALGMLSSFFMSSGIFSGFSLTVKAQEPDNNDDWLHVEGNQIVDMNG
NPVWLTGTNWFGFNTGTNVFDGVWSCNMREALTKMADRGINFLRIPVSTEILTGWKNGKP
AMPRSLNDYVNPELKGLNSLELFDFALDVCKEVGIKVMVDVHSPKSEAMGHNYPVWYDET
YDTEAWISALEWLTERYKNDDTILAIDLKNEPHGKPYEKLMAKWDNSTDINNWKYAAETC
AKRILKINPNLLIVIEGVEVYPKEGYDYTAVDEWGKESRYYYNWWGGNLRGVKDYPIDLG
QYQKQVVYSPHDYGPLVHKQPWFYDGFTKETLYNDCWKDNWAYIYEEGIAPLLIGEWGGY
MDGGPNEKWMIALRDYIVENRIHHTFWCYNANSGDTGGLVTHDFITWEEDKYELLKPALW
QHNGKFVSLDHKVPLGSNGISLSDVYGDAIPTPTRADVPTPTVSSPVTLVYGDLNGDDDF
NSIDFGLLKLVLLGLKSRTEINEKAADVDGNGHIDSIDYALMKQRLLGIIKKFPVEN
Download sequence
Identical sequences G8LY66
gi|374295530|ref|YP_005045721.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]