SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295542|ref|YP_005045733.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295542|ref|YP_005045733.1|
Domain Number 1 Region: 194-650
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.76e-89
Family Glycosyltransferase family 36 C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374295542|ref|YP_005045733.1|
Sequence length 657
Comment glycogen debranching enzyme, putative [Clostridium clariflavum DSM 19732]
Sequence
MRFGKSSWRTFEQGIQKEWLLTNGIGGFANSTIVGVNTRRYHGLLIASLKPPVSRHLILS
KIDESITIGDESFDLFSYEVPGFIMKGYHYMEGFEREPLPKFIFRVGDVYIEKTVSMVYG
ENTVAVVYYVRNGEESINLRLTPLVNFRDYHHCSRKENLNFYKSVAGKDSVILRPQNYDI
DITLFCSEGEFKPMDYCWFYNMDYSIERERGMASTEDHYIPGYFDINIEPNEEKYITVIA
TVEKELKLKDGLKIIGNEIERLEALVKKAGYDDELSKILVRSADSFIVHRESTNAKTIIA
GYPWFTDWGRDTMIALPGITLVTKRFDDAKDILYTFSRYVKDGLIPNMFPDEGNEPSYNT
VDAPLWYFEAVNKYISYTKDYDFVKDNIYDGLKQIIDYYKKGTKFDIRMDDDFLITAGNE
HTQLTWMDAKVGDWVVTPRHGKAVEINALWYNALRIMAELSERYGDSSKSYIELAQKVKE
SFENKFWNSEKECLYDCLTPNYKDDKVRPNQILAVSLSYPVIEGEMAKKVVNKVYKELYT
ANGLRSLSPKCREYVGIYIGDQYRRDGAYHQGTVWTWPLGHFITAYLRVNNYSDKSKKDA
MSFIEAIKDHLKDACIGSISEIFDGDEPLIPRGCYAQAWSVAEILRAYIEEDLNKGI
Download sequence
Identical sequences G8LY78
gi|374295542|ref|YP_005045733.1| WP_014254427.1.34793 WP_014254427.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]