SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295562|ref|YP_005045753.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295562|ref|YP_005045753.1|
Domain Number 1 Region: 1868-2003
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.83e-27
Family Intein (protein splicing domain) 0.056
Further Details:      
 
Domain Number 2 Region: 147-278
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-22
Family Galactose-binding domain 0.034
Further Details:      
 
Domain Number 3 Region: 45-113
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000491
Family Type I dockerin domain 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|374295562|ref|YP_005045753.1|
Domain Number - Region: 1496-1676
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.00262
Family Tricorn protease N-terminal domain 0.024
Further Details:      
 
Domain Number - Region: 1283-1455
Classification Level Classification E-value
Superfamily NHL repeat 0.00314
Family NHL repeat 0.032
Further Details:      
 
Domain Number - Region: 770-864
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00863
Family Methylamine dehydrogenase, H-chain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374295562|ref|YP_005045753.1|
Sequence length 2131
Comment RHS repeat-associated core domain-containing protein [Clostridium clariflavum DSM 19732]
Sequence
MKKSKRLFSLIISCVLLLQIITSTTIFGFAESTYAEEMSETNKGLVGDVDGNGEINSIDY
AYMKMVLLGIRKDFPIEDGLWAADVNGDGNFNSIDCAYMKMYLLGRIKEFPKKNIVVTPT
STPTITATPTITPTPTAPVQTIEPIPNDVARNKIAICSSFIGEGYDADKAIDGILNSMWK
AEGFEQWIRIDLGNEYTLNKTEFVVDGNKAYKYKIEVSMDDDNYTVIVDKTSNTSESDTY
TDGFQETKARFVKLTITGVEGSLDETIGIKEFRAFRTQQEPFPSVLPMPSPIIVTDYIRP
YVTLELQTEKVSVNEKIQIKTAATDDVGVENRTLKVNGTEIALNDDGTAEYIPDTAGVYK
VEFFAQDAAGNEGYASKEFRCVTASDGTKPQASITTPEFGTYVTMPINIMGTAMDANICN
YILEYSEKGQNNYIRFAEGTTNVESGVLGTFDPNTVKSGLYDIRLTVYDKGGLSNQTVTT
VFADGKMTLRNFSIAYTDISIPVVNGMPLEMKRYYDSTNRSKGDFGYGWTSEIDGIKLVE
SCKLSEGWSKNYAMGVYFVKEDKPHYIVISYPDGKTDKFAVKLKNIYATDPLGYYSLGTE
GMGTFEVIFEPVAGTYSKLVAENMEVHIYNSLFGNKFGLWKYFIDEFSDEVYSPGKYTLT
TQDGKVIKFNSSGKVESITDSYGVKITPQTDGLLYTRGSVTKKLSYTKADGVIKSASDLE
NNSVIYEYDKYGDLVSITDLENHKTKFVYDSEHRIIKVINSNNEVITRNVYDEAGRLVYI
YDAAGRRSEFTQQTVDSKEVITFTDRRNNPTVYTFNADGNLESVMDAAGYTTTYTYKDNG
LVDTITGPKGSFKYDYEMNSNGTIKKVRITDEAENYMECNYDAKGKIDTISDYSNTALNL
LDNDYDNYGRLVKTKDGNGGTISLKYDSSGRVESVTDQMNKEILKLYYDNVTGNLASYTD
ANNTVTTFGDYDANGRWRRAEFTRTVSEGITEVVTTINVYDNMGRIVENIDGAGRVSSVS
YNGIGKIDTFTDKYNNTVEYKYDCLGNLAEVIYQDGSSEKYTYDEEGNVTSYTDRNSKTT
YYTYDAMNRLESIVYQDGSTVKYEYNGAGDIKKVTDQRGNVTEYQYDSLGRLEYVFNSAK
PEDKIQYIYSNKPYPDEMVDGKGNRFVYSYNANGQLEKIKYSDNTTFEIEYDAAGRISTV
KDQNEKVTKYDYDAAGNLEKVTLAYGIEGKEEVWSYDYDEAGNLTSITDPRGKVTKMEYD
NVGRLKKQILPMKMNLEADYNDDEREVTVTDYNKNSIVYKYDDNLRLCIKETGDGNTVYF
EYTNEGYVKKVIDKNGTTSYEYDDLHRLIKKTNPDNSTVEYFYDWAGNCTGIKTKGGATS
YVYDVYNRLSKVISRDNKTTRYMYDAVGNLEYVLYPDGYKIQYVYDDQNRLTDIYRIKPD
GETVEYSYHYELGYAGERKKVTESSGRIVVYTYDDCYRLKEEKITDPLLGNRVISYEYDK
AGNRIEKNDNGIITVYEPDDNNRIRSAGSVKYDYDDNGNLKSKVDGNIVTTYQYDAENRL
ISVTETESGVLTNVETYEYDWEGNRISKTTNGVVTKYLVDSLGLSRVIEERDGNGNLLAY
YTYGNELISQTRNGVTSYFQYDGLGNVRRLTDEEGNVTDTYVYDAFGNILNRTGTTVNSY
MFAGEQYDANTGFYYLRARYMNPALGNFISMDPYSGSIYDPTSLHKYLYANASPVNFTDP
TGYFTIPEILASFQIHGVMNTLRCVALSSLLNAAKGGIAGAVFGGIDAALGGRDIVEGVM
QGTISGAAFGALATFAELRLILGVFGLENGVEGVFEAIEEGDYDLAAWRAVTTIAALISL
GSELFNRSACFTEETLIYTKDGYKEIKDIQVGDEVYSENPETGEKGLKRVLNVFVNEIKE
LVHLKVGDQEIKTTSTHPFWVEGKGWVDAGELKPGDRLVMYSGEVLEVDEAYVEYLDRSV
KVYNFEVEDWHTYFVSEYNVFVHNTVCGDSRVGNTQGSSKRITNRNGRKGGEAHQSVVNN
IKASNASGKIVREHYFRTPGGTKNYRFADAVEMVNGNIKRIYQVGKVNKNGLPVLRESLA
IYDIMNSPKYNGAPIYFLPYNANIGPIIYTY
Download sequence
Identical sequences G8LY98
gi|374295562|ref|YP_005045753.1| WP_014254447.1.34793 WP_014254447.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]