SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295714|ref|YP_005045905.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295714|ref|YP_005045905.1|
Domain Number 1 Region: 176-319
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.00000000000000227
Family Cellulases catalytic domain 0.078
Further Details:      
 
Domain Number 2 Region: 26-110,146-228
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.00000173
Family N-acylglucosamine (NAG) epimerase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374295714|ref|YP_005045905.1|
Sequence length 343
Comment hypothetical protein [Clostridium clariflavum DSM 19732]
Sequence
MVSSCFKGALKDDHIFRMTDDTGMLQHSKCSIPDPNFGYTTDDNARALIMALMLYERYKD
KKYLDLVYRYSSFLLNAQNEKGKFKNFMSYDRKWLEDEGSEDCFGRCIWALCFAISNEYT
PLGIKHGFSYILEKAMPHISNLYAVRAKAYSIIGLAHLDGEEPKSLIYETARSLCCKYEE
HRDGDWKWFEDIVAYCNNVLPWSLISAYRITKERKFLDVAEESLEFLERVTFKNGYFKPV
GCKGWFLKGESPAEYDEQTVEACEAVLTYCEAYEATGDKRYLQKAKRSHAWYECANSKGI
RLIDSETGGCYDGLTHDGVNLNMGAESLVSYIISYLKISDIDI
Download sequence
Identical sequences G8M0D6
WP_014254595.1.34793 gi|374295714|ref|YP_005045905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]