SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295760|ref|YP_005045951.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374295760|ref|YP_005045951.1|
Domain Number - Region: 27-86
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.0646
Family Cellulases catalytic domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374295760|ref|YP_005045951.1|
Sequence length 97
Comment hypothetical protein [Clostridium clariflavum DSM 19732]
Sequence
MQSKDFIETINFDEVFDFSIIIGNDKYVTTLCYGSNGYGDTLGWYFDAEDFDQKTFPFYE
WAERNYNAKIRSFGGGSPDIYMNYKENPEKEGLKKKL
Download sequence
Identical sequences G8M0I2
WP_014254641.1.34793 WP_014254641.1.85326 gi|374295760|ref|YP_005045951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]