SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295860|ref|YP_005046051.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295860|ref|YP_005046051.1|
Domain Number 1 Region: 30-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.56e-83
Family Xylanase/endoglucanase 11/12 0.0000000744
Further Details:      
 
Domain Number 2 Region: 475-696
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.65e-49
Family Putative acetylxylan esterase-like 0.00019
Further Details:      
 
Domain Number 3 Region: 251-372
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-30
Family Family 6 carbohydrate binding module, CBM6 0.0000484
Further Details:      
 
Domain Number 4 Region: 385-445
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000345
Family Type I dockerin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374295860|ref|YP_005046051.1|
Sequence length 697
Comment CBM6-containing protein,glycosyl hydrolase family 11,dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MKHKLMGKFSILMSLTLLLSLLPLNVQAKTVTSNETGTHGGYNYEYWKDSGNGTMVLKDG
GAFSCEWNNINNILFRKGLKFDETKTHQQIGYMTLTYSCDYQPNGNSYLAVYGWTSDPLV
EYYVIESWGTWKPPGNVQSKGTITVDGGVYDIFETTRYNQPSIKGNATFQQYWSVRQQKR
TSGTVSVTEHFKAWEAKGMKMGKFYEISLVVEGYQSSGKADVTMMSINIGGNSANPTGTT
VVPTPASGSGKSAFSTIEAEDFDNAYGSSIRSIGMGVGYIENGNYLVYNNINFGDGASAF
SAKVANGNTTATTIQLRLGSPSGTLIGSLSVPSTGGWNNYEELSTTVSGASGTKDLYLCF
NGPVNIDCFSFAKGNSNTNPINPGYILLGDVDQNGTINSLDYAKYKMYLLGMISSLPEEG
DINRDGDMNSIDYAMLKQHLLGIINLEELSGPKTTPTPVVIVTPTPTKTPSEGTFHCFLL
LGQSNMAGWARAQDSDKIPNPRILALGYDNNQWGVAVPPLHEAFQGAIGPGDWFAKTIIE
RLPENDTIGLIPCAISGEKIETFMKNGGSKYNWIVSRARMAQQRGGVIEGILFHQGESNN
GQQDWPNKVSTLISDLKKDLGLGDIPVLVGELLYTGSCAGHNTLVNRLPSMIPNCYVISA
QGLSGDPADFWGLHFNHDSTVEFGKRYAKKMIEVLGW
Download sequence
Identical sequences G8M209
WP_014254739.1.34793 gi|374295860|ref|YP_005046051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]