SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295921|ref|YP_005046112.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295921|ref|YP_005046112.1|
Domain Number 1 Region: 38-277
Classification Level Classification E-value
Superfamily SGNH hydrolase 5.27e-48
Family Putative acetylxylan esterase-like 0.00099
Further Details:      
 
Domain Number 2 Region: 282-352
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.28e-17
Family Type I dockerin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374295921|ref|YP_005046112.1|
Sequence length 353
Comment dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MIMKKANANLFVIGLLMLSMLFVAPTERIYASNSAKHKVFILAGQSNMAGCGMNHELSAE
YLGEQERVKIYAEGTVEASLKGTWSTLKPGFGSGSGCFGPELTFGREISKAYPDCEILLI
KCGWSGTSLQGDWRPPSAGGATGPLYKNLIETVNKAIGALDKSIDYEFAGMCWMQGESDA
CNIYPAREYEENLTAFINDVRKELNAPTMPFVIAMIDDSDAWVENAIVRQAQINVANKVP
YVYIFDTKDYDTDGMHYKTQGILDMGYDFAKAIISASDVPSKIVYGDVNGDGKFDSIDCA
TVKMYLLGMIEGFTYSEGFKAADVNGDENINSIDFALMKSRLLGIINKFPVEN
Download sequence
Identical sequences G8M2S4
gi|374295921|ref|YP_005046112.1| WP_014254794.1.34793 WP_014254794.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]