SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295933|ref|YP_005046124.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295933|ref|YP_005046124.1|
Domain Number 1 Region: 62-121,174-312,343-428
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.05e-22
Family beta-glycanases 0.032
Further Details:      
 
Domain Number 2 Region: 621-708
Classification Level Classification E-value
Superfamily PKD domain 3.4e-22
Family PKD domain 0.0019
Further Details:      
 
Domain Number 3 Region: 550-616
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.4e-19
Family Type I dockerin domain 0.00072
Further Details:      
 
Domain Number 4 Region: 447-540
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000336
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374295933|ref|YP_005046124.1|
Sequence length 865
Comment PDK repeat-containing protein [Clostridium clariflavum DSM 19732]
Sequence
MMNKKLAAFLLAFQMVVGSAVSNVLPVSAAQASVDVSIDTQANRLPISPYIYGVNQDLPG
QTVTARRLGGNRTTAYNWENNASNAGSDYIHSSDNYLVEYIGVPREDSEKPGAVATTFHD
QSLAQNVPYTLLTLQAAGYVSADKYGEVKPKDAAPSERWKEVKFAKNAPFSLTPDLTDDY
VYMDEFVNFLVNKYGSASSPTGVKGYSVDNEPALWAHTHSRVHPDPVTCEELVEKTAELS
KAVKNVDPDAEIFGPALYGFAAYLSLQSAPDWEAGLKDNYDWFVDYYLEKMKEKSDEAGM
RLLDVFDIHYYPEARGGGSRITFGEDSSNIECNKARLQAPRTLWQGSYREDSWIAEPWFD
SFRPILPRIQESINKYYPGTKLAITEYDFGAGNHITGGIAQADVLGIFGENNVYLATYWG
DRNKDYIVAGINLYTNYDGKGSKYGDISVKASVSNDELASAYASVEEADDGKLHIILLNK
NYDNSTIFNISINSDKQYKSGKAWGFDRASSQITQRPAVTRISNNKFTYTLPALSAYHIV
LDAADTTEPEVLVGDVNKDGDINVIDYALMKKYVLGMLDEIDVAAADINVDGEVNSIDCS
LMKAYLLGMIKEIPYYEETENEEPVASFTISNSEPVTDEDIIFDASDSTDPDGNIVYYAW
DFGDGSEGKGKTVKHKYAKPGTYTVKLIVTDDKYANSSPATKTITVTQATGDNSEFGFEG
TTQGFIVSGEKGTTATLSVTSENTFKGNGALKIDVVSADGGMFDVKLDGPSIVPPGSKVT
FRVWIPSNAPLSEIQGYVMPHDPSWSKIIWNGAWGGYEYMKKDAWNELTLIMPEDTDMSL
MQQIGVQFKTNDAAEFTVYVDSIDW
Download sequence
Identical sequences G8M2T6
WP_014254806.1.34793 WP_014254806.1.85326 gi|374295933|ref|YP_005046124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]