SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374295935|ref|YP_005046126.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374295935|ref|YP_005046126.1|
Domain Number 1 Region: 57-547
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.21e-119
Family Cellulases catalytic domain 0.0000000465
Further Details:      
 
Domain Number 2 Region: 565-720
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 7.85e-38
Family Cellulose-binding domain family III 0.00022
Further Details:      
 
Domain Number 3 Region: 742-888
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.05e-37
Family Cellulose-binding domain family III 0.00014
Further Details:      
 
Domain Number 4 Region: 892-957
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000301
Family Type I dockerin domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374295935|ref|YP_005046126.1|
Sequence length 957
Comment Cellulose binding domain-containing protein,dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MFNNSKKRVKKGRRRLSSLIAAGVVTAQILSSATVFANNEPPAGWKPVEGWENYNYFNFA
EALQKSIYFYDANMCGREAAYGALGRLEWRGACHEVDEEIPLERTNLSKEFLSKYRHIID
PDGDGKVDVHGGFHDAGDHVRFGLPQSYSSGTLGWGFLEFRESYKEIGEEQHMLDILKHF
TDTYLRCSFLDENGEMVAFCYMVGEGDEDHCYWGPPELYPEVYTNSRPADFATYDDPGSD
VCASTAASLCTSYLIFKDDDPEYANECLKVAKAMYDFAKKYRGLHKGDGYYTSDYDEDEL
AWAAVWLYECTGDMSYINDITAIDETGNYVGYMKRIIPDTYKQNVWYNSWVHCWDAVWGG
TFIKLNELFPENELFDFIARWNVEYLSGGKCPHEDPNDKNYCNPSPAGYTMINGWGSARY
NTAAQLCALVYMKNNPDRADFGEWAKSQMEYLMGRNPMGYSYIVGYGYEQGLPFAKHPHH
RAAHGSKTNSMNDPEEHRHILWGALAGGPDGSDFHIDSTTEYAYNEVTIDYNAAFVGACA
GLYKYYGQGHKPIENFPPKEPETDDFYCEAKVARETEDSTQVVLRIHNETTRPPRYETGL
MAKYFFNISELIEAEQSIDDVIFSVEYDEQISMQQNPVEVRGPFKWDNAGTYYYELDWSG
NKIYGDRDLQISFRVKQDANYMTHWDSSNDYSLQGVTKEFAICENVPVYINGELVYGKEP
PKLEPTPTPTPDPNATPVNDASIVVLYKSGQDDTKNTIRAAINIKNTGTTAVNLSDIKIR
YWFTNDGNEQNTFVCEYAPFGESKVTGKFYKIDNPVDGADTYCEITFAADAGRIVPGAST
GDIPFRIECSDAYDKTNDYSTDLNMKVFGENEKITAYVKGELKFGIEPVKTTYTLGDLDN
NGSIDSIDYAMLKMYLLGLTKFDEETYNRADVNRDTNVNSIDCALIKMYILGMIKSF
Download sequence
Identical sequences G8M2T8
WP_014254808.1.34793 WP_014254808.1.85326 gi|374295935|ref|YP_005046126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]