SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296137|ref|YP_005046328.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296137|ref|YP_005046328.1|
Domain Number 1 Region: 43-367
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.11e-57
Family beta-glycanases 0.0000455
Further Details:      
 
Domain Number 2 Region: 362-457
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.76e-18
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0028
Further Details:      
 
Domain Number 3 Region: 463-533
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.57e-17
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374296137|ref|YP_005046328.1|
Sequence length 534
Comment O-glycosyl hydrolase [Clostridium clariflavum DSM 19732]
Sequence
MRKTVSLTTVAALLISMLILVLPTNLYAASTVTVDWDTTYQTIDGFGVSEAFHQSNNIAR
LGETKQNEIYDLLFSTTDGAGFSIFRSILGDGGTWGNADDGPNKTMQPAEDVWDWNESND
DQIPMIRAIQSKYGVDQILYTVWSPPAWMKTNGSVVGGSLRTDKYQAYATYLAEHIKNYK
SKFGIEITHIGIQNEPNLETSYSSCRWSPEELRIFMRDYLVPTFDKENITAKVVFAENMS
FNEQYAINSLNDPIAVKRVDIVGAHNYGSSYIPFTTTKSKGKGIWMTEVSDMNGNDTTIN
DGLRWAKEIHDFMTITEGNAWFYWWGACFKTYNGEGLIQMDLNSKTYKVAKRLYTIGQFS
RFIRPGWQRIEATKNPVSNVYVTAYKDPKTGKFAIVAINNGWSKQSITYTLKGFSPASVT
PYTTSSTQNLEKGSDITVNNSSFSFELAPNSITTFVGDTESASIIYGDVNGDGDVNSIDY
GYMKWYLLGQINSFPVDNGDKVADLDGDGRITSIDCAYMKMYLLGMIQKFPVEQ
Download sequence
Identical sequences G8LU16
WP_014254990.1.34793 gi|374296137|ref|YP_005046328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]