SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296148|ref|YP_005046339.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296148|ref|YP_005046339.1|
Domain Number 1 Region: 40-78,105-519
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.62e-124
Family Cellulases catalytic domain 0.0000000326
Further Details:      
 
Domain Number 2 Region: 550-704
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.26e-25
Family Cellulose-binding domain family III 0.0006
Further Details:      
 
Domain Number 3 Region: 724-794
Classification Level Classification E-value
Superfamily Type I dockerin domain 6.08e-18
Family Type I dockerin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374296148|ref|YP_005046339.1|
Sequence length 796
Comment dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MGKSKRFSTKVKSLVASAAIAASAIIPVSISPAYAADVEINYAKALQYSQFFYDANMCGP
GVEENNLYDWRGNCHVYDAKLPLDSVNTNMSDSFIEKYRHVLDPDGDGTVDVSGGFHDAG
DHVKFGMPEAYAGSTLGWGFYEFREAYEATGQDSHIKTILRYFNDYFMRCTFLDESGKLV
AFCYQVGDGDVDHAYWNAPEIDEMFRRGWFANEELPSTDCVSAAAASLAVNYMNFKDEDP
EYAAKSLKYAKALFEFAEKTPEKSCNADGPKGYYTSLKWQDDYCWAAAWLFLATEDYHYL
EEVWKYYDYYAPSCWTHCWNDVWAGTACIIAEIDDKYDKNSDEFENAYRTATNKSPYEEI
DFWSQIAKTVDNWMNGVTVTITPGGYAFLNQWGSARYNTATQLLALVYDKHHGDKPSKYS
EWAKSQMDYIMGKNPLNRCYIVGYSENSVKYPHHRAASGLSRCEDPNPHKYVLYGALVGG
PDSQDQHIDVTSDYIYNEVAIDYNAAFVGACAGLYKYFGDETMKVTPNFPPKQVVDNPDD
DTGAGKYWVEAFCVDIVQSDGPKATEVTLYVYSNARKPSKNISVRYYFDATGMTSLDPNK
IELRQLYDQTAAETNYAAVLSGPHHYKDNIYYVEVKWPDFPVANSNKKYQFAIGTYAWQN
YWDPSDDWSHQDLPVFNDSWKGVPAKTDYICVYDDGVLVGGIEPDGTTPTVNPPPTPTPT
PVTKVIFGDLNGDETVNSIDYAYMKSYLLGMMKEFPSENGLIAADVNGDGDINSVDYALM
KMYLLGMIKEFPAASK
Download sequence
Identical sequences G8LU27
WP_014255001.1.34793 WP_014255001.1.85326 gi|374296148|ref|YP_005046339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]