SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296203|ref|YP_005046394.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296203|ref|YP_005046394.1|
Domain Number 1 Region: 30-99
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.08e-16
Family Type I dockerin domain 0.0016
Further Details:      
 
Domain Number 2 Region: 130-239
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 7.67e-16
Family Pollen allergen PHL P 1 N-terminal domain 0.066
Further Details:      
 
Domain Number 3 Region: 237-309
Classification Level Classification E-value
Superfamily PHL pollen allergen 0.00000000602
Family PHL pollen allergen 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374296203|ref|YP_005046394.1|
Sequence length 335
Comment endoglucanase-like protein [Clostridium clariflavum DSM 19732]
Sequence
MKRKIIFCCAILMTLLQFSFLNSFSLEGQVTVGDINGDGYVDSIDYANLKMYVLGLIKDF
PTAEGSWAADVDGNNSIDSIDCALMKSYLLGIIKKFPKSDSLPANTSAVTPTPQITPKPI
PSYSPYPDWDKEHSGYATFTGSGYSGGAALLDPIDPDMEITALNPYDYNSYGIDAALAGA
YLEVTGEKGSTIVYVTDLYPEGAPGALDLCPKSFAKIDDISKGKIDIKWRVVAAPVTGNV
SYRIKEGSTTSWLAVQVRNHRYPVLKMECYINNTWVDMKKMFWNHFVIDNVDTTTPRIRM
TDIRGYVLEDVLDSIPVSGDTRPAYIIDGNVQFPE
Download sequence
Identical sequences G8LUU0
WP_014255055.1.34793 gi|374296203|ref|YP_005046394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]