SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296205|ref|YP_005046396.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296205|ref|YP_005046396.1|
Domain Number 1 Region: 36-74,106-523
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.8e-127
Family Cellulases catalytic domain 0.0000000485
Further Details:      
 
Domain Number 2 Region: 723-872
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.25e-38
Family Cellulose-binding domain family III 0.00018
Further Details:      
 
Domain Number 3 Region: 541-698
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.15e-37
Family Cellulose-binding domain family III 0.00022
Further Details:      
 
Domain Number 4 Region: 884-953
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.14e-18
Family Type I dockerin domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374296205|ref|YP_005046396.1|
Sequence length 955
Comment Cellulose binding domain-containing protein,dockerin-like protein [Clostridium clariflavum DSM 19732]
Sequence
MTKKAFYKRGLSIFLSIAVAIGLTSSIPMTVNAEPEYNFAKALQLSLYFYDANKCGPGIT
GGRLEWRGDCHVEDKEIPLIPMTESFRGTNLSQSFINKYKSILDPDGDGKLDLSGGMHDA
GDHVKFGLPQTYAASTVGWSYYEFRDAFIKIGEQEHVEDILRWFNDYLLRCTFRDKDGKV
VAFCYQVGEGDIDHDYWNPPELQNSVMLEGFERPAYFATAETPASDQCAGAAASLAINYL
NFKDTDPEYASKCLDTAIALYEFAREYRGLGYSGGFYTSSYDYDELSWAAVWLKIATGED
KYIDHIVSTDESGKYTGYMQRIIVDTGNQWQNIWVHCWDTVWGGVFAKLAPITNTERDWY
IFRWNLEYWSGIPHEDPKDTNFLAKTPAGFSMLNSYGSARYNTAAQLCALVYRKETGRTD
FADWAKSQMEYIMGNNPMKRAYIVGYAPDGASHPHHRASHGSKTLSMDDPVDHVHTLWGA
LVGGPDADDFHKDVTSDYIYNEVAVDYNAAFVGACAGLYTYYGEGHEPIPNFPPKEERPL
EFFVEAKVSTSQENKERSQITIRIHNESAYPPHYETGLKARYFFNISELINAGQSIDDVQ
MEVYYDENEKCYDGKAKYLGPIKYDDSGTYYVEFDWSGRQIYASRELQFALVAAQDSNYK
GNWDPTNDYSRIGLKDEYVITERIPLYINDQLVFGEEPEKIEATPTPTGDPGNTSTPVPD
TVDLKVLYKCLTSSDSASDIRAILKIQNDGKKPVNLSDIKVQYWFTADSIAEPAFSCDFA
HISSSNVEGRFIKLDKKGEGFDRYLEISFTEEAGAIGAGANTGEIVIRIAGDGTGPYIQS
NDYSYNPLAKDFTENNKITLTYKSKLVYGEAPVDFVSPTPTPTPNVLYGDINGDKDINSI
DLAILKQYLLGMIKKFDVPDEVADLNGDGEINSIDYAYFKMYILGMIKEFPVNAR
Download sequence
Identical sequences G8LUU2
WP_014255057.1.34793 WP_014255057.1.85326 gi|374296205|ref|YP_005046396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]