SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296231|ref|YP_005046422.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296231|ref|YP_005046422.1|
Domain Number 1 Region: 128-327
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.16e-34
Family Acetylhydrolase 0.043
Further Details:      
 
Domain Number 2 Region: 47-109
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000118
Family Type I dockerin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374296231|ref|YP_005046422.1|
Sequence length 332
Comment lysophospholipase L1-like esterase [Clostridium clariflavum DSM 19732]
Sequence
MYLVYFSCGNGFGISFFTGFIPGQKVNAAEYPGTTIVPTPAATRLVITIYLGDVDENKVV
NSLDLAKYKQYLLGEIKSLPEAGDVNQDGEMNSIDYALIKAYLLGLVKDLGTKTIWGPPV
PTPYVPTPTPIQTPKPTIKIMPLGDSITDGITVPGAYRTRLWKNITSNGYNVDFVGSMTG
GPSDLGDKNHEGHSGWRIDQISNNINYWMDTYKPQIVLLHIGTNDISQKYDLNNAPNRLS
DLIDKICAKLPADGKLYVATIIPISYADVRTYNSQVAAVVQNKASQGKPVYLVDMYSALT
LSDLADGVHPNANGYNKMGDVWFNAIKGDLAR
Download sequence
Identical sequences G8LUW8
gi|374296231|ref|YP_005046422.1| WP_014255083.1.34793 WP_014255083.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]