SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296313|ref|YP_005046504.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296313|ref|YP_005046504.1|
Domain Number 1 Region: 187-322
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.4e-23
Family Cellulose-binding domain family III 0.00088
Further Details:      
 
Domain Number 2 Region: 117-158
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.000000196
Family Copper amine oxidase, domain N 0.019
Further Details:      
 
Domain Number 3 Region: 36-77
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.000000458
Family Copper amine oxidase, domain N 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374296313|ref|YP_005046504.1|
Sequence length 324
Comment copper amine oxidase family protein [Clostridium clariflavum DSM 19732]
Sequence
MKKFISGLIIGGILATSVCTFAEEATSWKAELPTFKVFVRGEEFISENPPVVVEGRTYLP
LRAMGDALGVPVEWNAELRQAEVAMTDKKPDSTQTNTPVQPATSTVTSWTAYKATFKVMV
KGQEFISENPPIVVEGRTYLPLRALGDALGVPVEWNADLRQVEVDMKTTVTPTPQVTPKP
TDTTKTVIGTIKAEPATTIDVPINVSFDTTRGLNTFNLTLAFDNDNLEFVEVKPGDIITD
PDTNFAYHYSQDENLIRMLFLNETMQEDGVIRTEGVLATVRLKVKDNAKSSESELAIVGK
ATFADTKLSTLDIELSTGDVTVVK
Download sequence
Identical sequences G8LVJ1
gi|374296313|ref|YP_005046504.1| WP_014255160.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]