SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296377|ref|YP_005046568.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296377|ref|YP_005046568.1|
Domain Number 1 Region: 506-818
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.49e-78
Family beta-lactamase inhibitor protein-II, BLIP-II 0.01
Further Details:      
 
Domain Number 2 Region: 109-351
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.14e-77
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 3 Region: 345-540
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.15e-44
Family beta-lactamase inhibitor protein-II, BLIP-II 0.032
Further Details:      
 
Domain Number 4 Region: 37-106
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000226
Family Type I dockerin domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374296377|ref|YP_005046568.1|
Sequence length 819
Comment RCC1 domain-containing protein, alpha-tubulin suppressor [Clostridium clariflavum DSM 19732]
Sequence
MLGKRISLAVLISIIAVISVNSVFAQKENSAISTSKAVIGDLNGDFKFDSIDCALMKMYL
LGMIKSFEVEDELYAADVNGDTLINSVDFAYMKKMLLGMITEFPKKSMEGFVQVACGEYH
TIALKKDGTVWTWGYNSYGQLGLGEAGEIERIPKKIEGLEDVIKVAAGSRHSLALKKDGT
VWAWGYNYYGQLGDESNIRRNTPVQVKGLTGVKDIDAGDFFSVALRDDGTVWGWGYNYKG
QIGCGTGINSNVPLQTVGVSNITQISAGDEHVLALDKDKNVWGWGAGDKGQLGNGTAASF
LRIPEKLSSFTEVKSVKAGTMVSAAIKEDGTLWIWGDNTYGIMGNSRNINSSPVQRKDIS
GIKAVELNQYCAAALKNDGTVWTWGKNINGILGLGTALDSQIPSVVSGTGDVEVISCGKT
HMAIIKSDGTLWTWGYNIYGQLGNGNVDYITEPVTINGISNISKISCGGKHVLAIDENKT
LWAWGNNDYLQLIDDVGLSAESGSNDYCIPFAVKSEKDVKDIVAAFNRTLVVYEDEEVWI
YAAKNTVAGDEQSVYLPYKIEGLEGVTDVSVGKNHILALKDDGYVYSAGNSYWGQLGDGS
QTHHNSYSETFNLTKAKGLTNIVAVAAGSEHSVALKNDGTVWTWGSNQFGELAHGNDTFS
LEPMQAEGLENICAISAGNNYNLALKEDGTVWAWGDNTYGQLGNGSTYKTNVPVQVDGLE
NIVKIIAGRDSSFAITKDGDVWAWGKNNCGQLGDGTTQNRLTPVKIDAFKGCKSIVSGMD
FTMVLMNDGTVIGVGSNVSGVMTLGFSDRSFIPIEVKIK
Download sequence
Identical sequences G8LW40
gi|374296377|ref|YP_005046568.1| WP_014255224.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]