SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296413|ref|YP_005046604.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296413|ref|YP_005046604.1|
Domain Number 1 Region: 275-588
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.05e-91
Family beta-glycanases 0.00000096
Further Details:      
 
Domain Number 2 Region: 31-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-83
Family Xylanase/endoglucanase 11/12 0.0000000946
Further Details:      
 
Domain Number 3 Region: 596-659
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000373
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374296413|ref|YP_005046604.1|
Sequence length 660
Comment beta-1,4-xylanase [Clostridium clariflavum DSM 19732]
Sequence
MHSSKLKNLAKIISITFLFSLFALNNVQAQTVTSNQTGTHGGYNYEYWKDSGNGTMILKD
GGSFSCSWDNINNILFRKGIKYNETQTHQELGYITMEYACDYRPNGNSYLAVYGWTSNPL
VEYYIIESWGTWKPPGNVGSKGTITVDGGTYDIFETTRYNQPSIKGNTTFQQYWSVRQQK
RTSGTISITEHFNAWERLGMRMGKMYEVSLVVEGYQSSGQADVTYMSIKVGNSPNSTSQP
YYPQPTNSNNSNNSNNNQTSGQPLRVLTKQLRERGREFYIGCAVPSYFSAADQEIVKREF
DIITCENDMKIGTISPNQNQFNFSGGDRIVQFAKENDMKVHGHTFVWHKYNPWWVDGTKS
MMESYINTVATHYKGDIYVWDVVNEAFHRDGSYRINAIGTNGQDGASIYGQKQGTKYIED
AFIAARKADPNAKLIYNDYDLMMRDVKFEAVYQMVKDFKSRNIPIDGVGFQAHLGPDFTE
ERARAFGQKMQSLAALGVESYVTEMDVGCQDTSQAGLQKQADVFRWITEECIKQPYCRAL
QVWGIRDSQSWRINPESPEDRAIAPLIFDDNGQKKPAYYAIQQVLEDALNSQILPQIVEG
DTNGDGEFNSIDYATLKQILLGINTENRYIYWEQASDLDKNGTVDSIDYALMKMRLLGIK
Download sequence
Identical sequences G8LWL2
gi|374296413|ref|YP_005046604.1| WP_014255260.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]