SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296427|ref|YP_005046618.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296427|ref|YP_005046618.1|
Domain Number 1 Region: 310-511
Classification Level Classification E-value
Superfamily SGNH hydrolase 5.34e-32
Family Acetylhydrolase 0.0079
Further Details:      
 
Domain Number 2 Region: 29-224
Classification Level Classification E-value
Superfamily SGNH hydrolase 7.94e-32
Family Acetylhydrolase 0.0051
Further Details:      
 
Domain Number 3 Region: 536-598
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000128
Family Type I dockerin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374296427|ref|YP_005046618.1|
Sequence length 600
Comment lysophospholipase L1-like esterase [Clostridium clariflavum DSM 19732]
Sequence
MHKLRLKASKMILSLFLISAIIGGMFAVPSFGAGRTIKIMPVGDSCTEGMGDPDMGGYRT
ELYRLYTEAGLSIDFVGSNRRGPNSLPDKDNEGHSGWTIPQIASNIDNWLNTYNPDVVLL
WIGGNDVLLGGNVNTTGLSNLIDQIFRTKPNVTIFVADYYPWPEQIKQYNATIPGVVQQK
ASAGKRVYFVKLSDMQFSPNVDLSSDGLHLNVNGYSKIARIWFNSTINILREMAGTPDTQ
PNPTPTPVPGNDFPFPWFGTPTPTPAPGNDFPFPWFGTPTPTPAPGNNFPFPIPGDFPFP
WFGSPTPAPNFPTATPNVPSSGKTIKIMPVGDSCTEGMGDPDMGGYRTELYRLYTEAGLS
IDFVGSNRRGPNSLPDKDNEGHSGWTIPQIASNIDNWLNTYNPDVVLLWIGGNDVLQGRV
NTEGLSNLIDQIFRTKPNVTIFVADYYPWPEQVKQYNATIPGVVQQKASAGKRVYFVKLS
DMQFSPNVDLSSDGLHLNVNGYSKIARIWFNSTINILKEMAGTPNTQPTPTPIGNVKKGD
INGDGEVNSIDYALLKRYLVGMDTTLPTPNSYAAADINGDGDINSLDYANLKLILLGMNN
Download sequence
Identical sequences G8LWM6
WP_014255274.1.34793 gi|374296427|ref|YP_005046618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]