SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296519|ref|YP_005046710.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296519|ref|YP_005046710.1|
Domain Number 1 Region: 510-848
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.35e-101
Family beta-glycanases 0.000000188
Further Details:      
 
Domain Number 2 Region: 1023-1208
Classification Level Classification E-value
Superfamily CBD9-like 1.1e-41
Family Family 9 carbohydrate-binding module, CBD9 0.00000402
Further Details:      
 
Domain Number 3 Region: 350-500
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.33e-32
Family CBM22 0.0072
Further Details:      
 
Domain Number 4 Region: 192-342
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.69e-32
Family CBM22 0.013
Further Details:      
 
Domain Number 5 Region: 40-189
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.48e-31
Family CBM22 0.0061
Further Details:      
 
Domain Number 6 Region: 861-1015
Classification Level Classification E-value
Superfamily CBD9-like 5.49e-17
Family Family 9 carbohydrate-binding module, CBD9 0.00032
Further Details:      
 
Domain Number 7 Region: 1214-1303
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000745
Family Pre-dockerin domain 0.00012
Further Details:      
 
Domain Number 8 Region: 1313-1369
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000523
Family Type I dockerin domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374296519|ref|YP_005046710.1|
Sequence length 1371
Comment beta-1,4-xylanase [Clostridium clariflavum DSM 19732]
Sequence
MKARGIISLVTVLSFLVSALFIGNVSAFTVEQETNLFPFATGFENGTLSGVNNKYTEKNT
IVSDIAHGGTKSLKVSDRTYAWEGPQINLLGKVEKGETYYCSAWVYQDSGEPQTFRMTAY
SCDDTSEDLYDSKFYTTIAENLEVPSGEWTRLEGLYTYKYEGSPIDMVIYVEAAEIGFDF
YVDDIIIVGPAVVNSNFENNSTAGWSGAGSVLAISDKVANSGDYSMEVTGRSNPWEGPTV
NLMGKLVKGNTYYASAWVYQDSGEPQPFKFTAYCPDDTSENLYDAKFYTTVAENLEVPSG
KWTKLEGLYTYDYTGEPLGLTFYLESPELGFDFFVDDIVIAGKIKDPKEDAIICNTSFEE
SKFDGWTANGTGTDAKLYINGSTAHGGFKSLFVTGRADTWQGAKFDLMNKVKKGQTIEVS
MWVYQTSGKPQEMRITICTDADGDPTYNTIAVDYEVPSRTWVELKGTYTITYTGELEQLF
IYVESGHPTTEIGIDDVLIVAPLPEEGIEPDIPSLKDVYADYFPIGVAVPSSAFDNQLQS
DLIKKHFNSITAENDMKIDSMQPREGSFNFAKGDRYVEFTQENGMRLRGHTLLWHQAVPS
WIFVDDEGNDVSREVLLERMKTHIKTLIKYYGDKVEVWDVVNEAIGDSQPYGLRNSKWRQ
IIGDDYVIKAFDYAYEALVEEGLVGKVKLYYNDYNNEENPQKREAMLNLVKELKEKSHID
GVGHQGHIGINYGSVEGIKETLKGYLDLGLEVEITELDMSVYNSLTEPNAPITEEQLIKQ
AYKYKELFDMLKKLAEEYPGKIKGVTFWGLKDDMTWLNYHDGISRTDAPLLFDKYGKAKY
AYWALVDASKLPVFINNALSFKGSPIIDGSKDDVWDIAKSVNIVDSNGNVKGTVKTLWDD
ENLYALLKVNGEPSKIEFYIDENNSKNERNETEDVYYAFTASGETTGAVTVISNKTEDGY
EFEVCMPFIDSPASKIGFDVRLTYGEGDAAVKVSWNDTKNNQDADTSGYGVLRLINPKYT
EALKGTPIIDGEVDDIWADANEISTDIITAGTNPSKATVKTLWDENYLYVLAYVEDNNLC
DAAENPWEQDSIEFFIDENNGRTAEYEYDDAQYRVNYNNVQSYGANCLDDKFVTVTKFVY
GEDTVTGYLVEAAVPFKTPKSAGHIMGFDVQVNDDSDANGVRDGMSNWNDATGVGYKNTE
AFGLLKLVEGADKYSVSGYIKSDFMYNEDKLSEIESGFVVEIVGTGLKAESKDGYFKISG
VPAREEGYTLKITKANYLAREIKNVVVTGNIEISTQDAPIIMWAGDMVINGQQDNAINME
DIMHICKSYNAVKGDDRYEESSDINKDGAINMEDIMIVGKHYNRISSHYDN
Download sequence
Identical sequences G8LX95
WP_014255365.1.34793 gi|374296519|ref|YP_005046710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]