SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296591|ref|YP_005046782.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296591|ref|YP_005046782.1|
Domain Number 1 Region: 197-504
Classification Level Classification E-value
Superfamily RNI-like 0.000000000196
Family Rna1p (RanGAP1), N-terminal domain 0.065
Further Details:      
 
Domain Number 2 Region: 8-45
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000654
Family Type I dockerin domain 0.003
Further Details:      
 
Weak hits

Sequence:  gi|374296591|ref|YP_005046782.1|
Domain Number - Region: 93-142
Classification Level Classification E-value
Superfamily PKD domain 0.000654
Family PKD domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374296591|ref|YP_005046782.1|
Sequence length 541
Comment hypothetical protein [Clostridium clariflavum DSM 19732]
Sequence
MKGTLLSKLTIGNITLADLNGDGYINSLDLALLKMYLLGKISKFPIEDLNPIITPTPEQE
VTPTPAISVTPTPTKIGEEVFEFKIKISNRGGVYYFPIKSSDKKYNIDVDWGDGIRSNIT
DYSARGHKYEKAGTYTIKVFSFDYMPLFFFNDKNLIEVITPIPDLGDKYFHSFFNGCENL
EKIPEGLFANNINATSFAYCFDGCSSLMEIPEGLFANNINATDFSGCFSGCERLKEIPEG
LFANNINATSFEYCFKGCSDLIEIPEGLFANNVNVTNFSGCFYLCSGLREIPEVLFANNI
NVISFMECFGSCENLREIPRGLFSNNINVKDFSYCFTGCSSLREIPEGLFDNNINVTTFC
QTFWACTSLTEIPESLFENNVNVTNFIGCFRSCSSLMEIPEGLFDNNIKAANFLFCFSEC
INLTEIPKGLFDNNINVTDFSKCFERCENLREIPEGLFDNNVNVTDFSYCFYGCGNLTKI
PEGLFDNNINVTDFEGCFCHCRGLTGLAPALWQRSNVTSHKYCFYSCTELDNYYDIPRDW
R
Download sequence
Identical sequences G8LXV5
gi|374296591|ref|YP_005046782.1| WP_014255437.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]