SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296659|ref|YP_005046850.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296659|ref|YP_005046850.1|
Domain Number 1 Region: 8-107
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000000000000334
Family Intein (protein splicing domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374296659|ref|YP_005046850.1|
Sequence length 253
Comment hypothetical protein [Clostridium clariflavum DSM 19732]
Sequence
MSIQAKKGLKTVKQLFVNETYELIHIYVGYSQIKSTAPHPFWVEGKGWVEAGNLLEGDKV
KLYSGEVLEIKEIRRERLEEPVKTYNFEVEDWHTYLVSENNVLVHNAGSKKCPLKFSFKS
NKSNAGNNNVKSKLRDSRTINFSQKSIDSKFSDGTNIKDTIYRLKNDPSYAEKMEPIRIV
KYKDLPADVQQKLASQNVGKHTVFTLDNRRLYAARKAKVKVNTRWATPEEIQNFATVKRF
TTINGGKMPEVRW
Download sequence
Identical sequences G8LYF7
gi|374296659|ref|YP_005046850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]