SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296669|ref|YP_005046860.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296669|ref|YP_005046860.1|
Domain Number 1 Region: 401-534
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.66e-26
Family Intein (protein splicing domain) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374296669|ref|YP_005046860.1|
Sequence length 698
Comment RHS repeat-associated core domain-containing protein [Clostridium clariflavum DSM 19732]
Sequence
MTYHYDRSNRLTDVLEVRNGSNITTVYTYDGNGNQIKVAATEPGDVINVSEYTFDGFNQL
KVAKTQDSTSTSKYDAFGLRVEKTVDGVTTKYYYDGQSILLEVRSDGLESHNIQGVNLIA
RKIKGDSDTLYYLYNGHADVVKLVDGAANTVNEYDYDIFGNILYQLESKPNPYKYSGYYY
DDDTGYYYLRSRYYDPKIARFISEDTYTGEYNDPLSLNLYTYCQNDPITYDDPNGHWLHI
AAGALIGGLVNTAITAVSDFMEDGKFNKSWREYAGSFAEGAITGAIGAATGGASFIAAAA
ASAAGSVVGNAVGQYISKGKVDVKEALFAGATDLVTMGAGKLAGNLTKKGMNKLAKTAFG
ENVLKKANSVKSKVLNKISGVKTKVQSIVKRECKHPELGMCFTADTLVYTKDGHKRIEDI
KVGDQVYSVNVDTGEKGLKTVKQLFVNETYELIHIYVGYSQIKSTAPHPFWVEGKGWVEA
GNLLEGDKVKLYSGEVLEIKEIRRERLEEPVKTYNFEVEDWHTYLVSENNVLVHNAGSKK
CPLKFSFKSNKSNAGVGKTSTEYQSTLNSIRNKMPNTNLSKRGNMAYAEVDINGLKNEYI
AHSKINSSVDKGADIADFSYLKPENERIFNSYVDDSFPRFHDTEAKILEDIASGIKNKNI
NGTVNLYSELPCCQSCSNIVLEFRRMFPNVKLNVIVGK
Download sequence
Identical sequences G8LYG7
WP_014255507.1.34793 gi|374296669|ref|YP_005046860.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]