SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296745|ref|YP_005046936.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296745|ref|YP_005046936.1|
Domain Number 1 Region: 31-335
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.14e-68
Family alpha-L-arabinanase-like 0.001
Further Details:      
 
Domain Number 2 Region: 329-460
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-33
Family Family 6 carbohydrate binding module, CBM6 0.00029
Further Details:      
 
Domain Number 3 Region: 482-546
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.37e-16
Family Type I dockerin domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374296745|ref|YP_005046936.1|
Sequence length 547
Comment beta-xylosidase [Clostridium clariflavum DSM 19732]
Sequence
MIKRHYKAWAIILTIGLLTVLMPQKSFADYPIFSQRYTADPTAIEYNGRLYIYCSHDVDV
TPGQNTYNIPDITCISTDDLKNWTDHGEVFNASKDSSWANKTWAPSVVYRNNKFYLYYGN
GGNGIGVAVSDSPTGPFKDPLRGPLVSTNTPGVLPANNMWLFDPGVFIDDDGQAYMYFGG
NGASNIRVIKLGNDMISTVGSAMTMTAPRFFEAAYMHKYNGNYYFSYASDYSQGASKIEY
MMSNNPISGFTYKGVILPQPPDNFNNNNHHSIVQFKDNWYCVYHNRTVSKSRGVDTNYQR
NVCIDQLFYNADGTIKQVVPTVDGLPQLKYVNPYIENLAVTMHKENGIETEECSEGGRNV
GFIENGDWIQVKGVDFGSSGAKGFEARVASDTNGGKIEIRLDSVTGKLIGTLNVPSTGGW
QKWVTEKCDVSGVTGVHDVFFRFTGGSGYLLNFSKWKFIPVSEATPTPTPAPIVTPTPTT
VKTKLGDINGDGDINSLDFAEFKMYLLGMTDKISNADLNGDNDVNSIDYALLKQYLLGMI
SVFPAEA
Download sequence
Identical sequences G8LZ68
WP_014255580.1.34793 WP_014255580.1.85326 gi|374296745|ref|YP_005046936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]