SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374296746|ref|YP_005046937.1| from Clostridium clariflavum DSM 19732

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374296746|ref|YP_005046937.1|
Domain Number 1 Region: 28-223
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.51e-33
Family Acetylhydrolase 0.011
Further Details:      
 
Domain Number 2 Region: 245-308
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000157
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374296746|ref|YP_005046937.1|
Sequence length 312
Comment lysophospholipase L1-like esterase [Clostridium clariflavum DSM 19732]
Sequence
MYNFKLKVKKILFSAFLIGAIVGNMFTAVPAQSAPIKIMPVGDSCTEGMGDPYMGGYRTE
LYNLYKNAGLNFDFVGSNQQGPSSLPDRDNEGHSGWTIPQIASNIDNWLNTYNPDVVLLW
IGGNDILQTGRMNTTGLSNLIDQIFRNKPNIKLFVANYYPWPDVVKPYNEAIPGIVQQKA
SEGKSVYFVKLSDVQFSPSVDLSSDGLHLNPGGYSKIAKIWFESTISVLREMSNGPVPTP
TPSFNVKKGDVNGDGDVNSIDFAYLKRYLLGMDSSFPSPYGSIAADLNNDGRIDSIDYAH
LKLILLGMYYEN
Download sequence
Identical sequences G8LZS3
WP_014255581.1.34793 WP_014255581.1.85326 gi|374296746|ref|YP_005046937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]